SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA08021 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA08021
Domain Number - Region: 12-90
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000521
Family Protein kinases, catalytic subunit 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA08021   Protein: PP17577   Gene: WBGene00097575
Sequence length 91
Comment PP17577 WBGene00097575 status:Predicted
Sequence
MRLETTLEVRRSPTINYTNPAFGQKIQSIAYCPSTAQPFLGKYSSCIYQRGRKTKILQYL
PELEQFVALLTSYKDSDRPDCVEILRHPFLP
Download sequence
Identical sequences H3EE69
PPA08021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]