SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA08237 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA08237
Domain Number 1 Region: 160-416
Classification Level Classification E-value
Superfamily Caspase-like 1.21e-72
Family Caspase catalytic domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000174
Family Caspase recruitment domain, CARD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA08237   Protein: PP29522   Gene: WBGene00097791
Sequence length 417
Comment PP29522 WBGene00097791 locus:Ppa-ced-3 status:Confirmed
Sequence
MAGSMQNEHRKALIGFGDSSLPPLYLDPILDYLEVKQVLPESKINEIRRMSNGRLDLMRS
LTKQGSIAFDEFFLSLVHSQQVHLADSLRPLVSQSVIASLENKGTEQKASSSIEGFERME
IDEERAGGGGRYDSDGNGKSSFSSFDLRDIEKKLASYEAQKGERVYQFTSPRGYALIISN
EHFRTMPQRRGTKADVIALKNLFISKLGYEVEVHENLTGKELHNNIKSFASSTKHSFTSS
AIVCILTHGEHDVLYGVDDQVVDVHYLLSSFNTHNAPHLAGKPKIILLQACRGERKDIGY
EETDSGRPFAFLECLGMGGGGMMTRNKRPAESDILVAYATPAHYVSWRNSEKGSWFIQSF
VEVAEKRSHDSDLLSILTQVNAKVAETYKANSSTGEYKQISEFSSKLTKKFFFFPPE
Download sequence
Identical sequences Q9Y1U6
PPA08237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]