SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA09583 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA09583
Domain Number - Region: 6-60
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0302
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA09583   Protein: PP20452   Gene: WBGene00099137
Sequence length 105
Comment PP20452 WBGene00099137 status:Predicted
Sequence
MTIMNLRSADSPASSTESIQRLLDEVKRLKAENQKLRGKVEVDLSNSQDLKEWPRKDLLK
LIAQLESKEVRKPVQAAVKKLQEMGDTMSLHDQLKLARETVDSLK
Download sequence
Identical sequences H3EIL3
PPA09583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]