SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA09645 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA09645
Domain Number 1 Region: 6-156
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-31
Family SH3-domain 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA09645   Protein: PP24160   Gene: WBGene00099199
Sequence length 171
Comment PP24160 WBGene00099199 status:Predicted
Sequence
MEKVADYKAVAFSICTNVEYDGSLDDDSPVHGCAVSFKIKDYLHIKEKYNNDWWIGRLVK
EGCDLGFIPSPVKLETLRMQQQKGGAKFKQSTSTSNLGNLDAMMPRSGSRGSSPPTPGIH
DDEHKNLKNVVTTPPTKEKKKLIFKKQEVLNPYDVVPSMRPVVLVGPSLKG
Download sequence
Identical sequences H3EIS5
PPA09645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]