SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA10351 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA10351
Domain Number 1 Region: 52-161
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-17
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA10351   Protein: PP29355   Gene: WBGene00099905
Sequence length 166
Comment PP29355 WBGene00099905 status:Partially_confirmed
Sequence
MAEGWFKFTGSSPYPTLTTNFDHSKFTYGNMQNRQFRMGWASLMIFLIFSRIEGKRDEGK
ERNILEWISRSNRISFVDRDDAAAKLSDGIILCEFVNNINSQALARNISHKSSRFAATEN
LENFQDGLIALGMNKSQLFPISDLIEKKDISSLVNTLDILKQMLGF
Download sequence
Identical sequences H3EKR5
PPA10351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]