SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA10367 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA10367
Domain Number 1 Region: 119-253,292-308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.52e-25
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Domain Number 2 Region: 58-114
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-17
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA10367   Protein: PP03422   Gene: WBGene00099921
Sequence length 314
Comment PP03422 WBGene00099921 locus:Ppa-mlk-1 status:Partially_confirmed
Sequence
MKNGETEAGFEDYVNMDHMGQPANVSKGRASRHSGIDDPMPFQPDAVRMRNNNGEDEQIY
EICYDYKARQHDELDLRRGSVVKVVKDAETGWYQGLVDGKVGVFPKNYIRAIGRCNFKNI
RASEIELSFLIGEGAAGQVYHANYHGKSVAFKKYKFIGREREREEDVIEKITYSVKREAA
YFSNLRHENIVELYGVCLDSPTIGLVLELCQAVPKRILVDWAQQMCAAMEAISSKFVHRD
LKMDNVLVLQKVCFCALPNGKSTPDRPNSDLYSHDKIQANGVCSECGGTAFDRLKLKLTD
FGLTRENSSERHEF
Download sequence
Identical sequences H3EKT1
PPA10367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]