SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA10393 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA10393
Domain Number 1 Region: 306-376
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-20
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 224-290
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000684
Family PDZ domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA10393   Protein: PP20731   Gene: WBGene00099947
Sequence length 391
Comment PP20731 WBGene00099947 locus:Ppa-tag-117 status:Predicted
Sequence
MEELANGGSHLQPTVHTSCNGSTNEEQTRIKRYDDDIRERKERQFQRQKENELLRSSLRA
SKKLKALTINENNNSTNNSGMTRGEDVIETSLDEVDALQGIKEDRSGYENESFVVSDSSC
REVMDDSVETPDEQPNLDQIILSVERIAEHLNSSEGRPEEGRLIRDFFTSPPVKSAIQAS
SHHSPIECSSRIPHEEIGPSSNLRIVTLYKDNDNYLRSVETSERKRMKLQGATVRNEEHR
MVVGRVVAGGIAERTGLLQEGDELLEVNGLELRGRNVGQRGLRGEIRLVINTDGRKARNR
LENVKKLRSLFNYDPHDDVFVPCRELALSFSRGDVLHILDTSDSNWWQATLDGSNCRDQL
AGIIPSPSFRQQFVILVVIAASSSLSTRRRK
Download sequence
Identical sequences H3EKV6
PPA10393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]