SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA10472 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA10472
Domain Number 1 Region: 81-292
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-53
Family DBL homology domain (DH-domain) 0.00000787
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000223
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA10472   Protein: PP06642   Gene: WBGene00100026
Sequence length 336
Comment PP06642 WBGene00100026 status:Predicted
Sequence
MYPVEIRVAEAVADHVAVLSDELPFARGDSITVIDTSSPSGLWYGACRDSQGWFPASYVT
IISSTSSTDSSNEVDDANNFPEAMRRQRARAVEELLKTERDYVQLLDNLVHGFLEQTYRR
SDLFPREAVDVIFSNIPQLLGLHVRLLRQLEMSLDPLRPEDSMIGGAFLRHKQHFTVYAP
YCNNRPLSCSRLASLTRQPVYHQFFDACRLLRGMPHLSLEAFLLTPVQRICRYPLQLQQI
YKVTPVGHADRHPLSCAVRAMKEVACQLDERRRRIESIQAIALWQASLHSWKGPDLIERN
STLIKNGDVMCRCVTGGNHWTKQENVPPTVFYGILP
Download sequence
Identical sequences H3EL32
PPA10472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]