SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA11083 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA11083
Domain Number 1 Region: 55-155,183-208
Classification Level Classification E-value
Superfamily SH2 domain 3.74e-31
Family SH2 domain 0.0000493
Further Details:      
 
Domain Number 2 Region: 3-77
Classification Level Classification E-value
Superfamily SH3-domain 1.16e-17
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA11083   Protein: PP12750   Gene: WBGene00100637
Sequence length 216
Comment PP12750 WBGene00100637 status:Predicted
Sequence
MEAIADHDFNATAEDELSFTRGSVLKILNKDEDPHWFKAEIDGVEGFVPSNYIRMSDHSW
YLGKISRVDAELLLLKQGTHDGAFLVRQCESFPGDFSISVKYENRIQHFKVLRGDQGKYY
LWDVKMFNSLNELVEFHRTSSVSRSKTILLRDIDSEVKFVQALFDFNPQDAGELSFRRGD
IITILSKDGDPWWEGQLHNRRGQFPANYVCPYKRQN
Download sequence
Identical sequences H3EMU1
PPA11083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]