SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA11158 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA11158
Domain Number 1 Region: 1-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-69
Family Motor proteins 0.00000264
Further Details:      
 
Domain Number 2 Region: 590-652
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-22
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA11158   Protein: PP09516   Gene: WBGene00100712
Sequence length 673
Comment PP09516 WBGene00100712 status:Predicted
Sequence
MSLLDDTCAQNHGQSEGVDHQFLSTLNKACAHHEHYKSGADCFVVKHYAGDVVYNIDGFA
ERNRDVLYPDLIQLMHNSFIRELFPHESAIGAGKKPTSFSTKIRSQANELVTSLMQCTPH
YVRCIKPNETKKPNDWDENRVKHQVEYLGLKENIRVRRAGFAYRRAFDKFVWRYAIISEK
TWPNYRGDPKQACEIICATVNMDRDQYQMGRTKIFVKNPESLFLLEEMRERKYDAFARKI
QKAWRRFNARKHHSKMKEQASDLLVGKKERRRFSLNRNFALVGKRERIDFAATVTKYDRR
WKVSKLDMILTAKHITLIGRERVKKGPQKGQLVEIVKRQIDLTRIASIGLSPYQDDFIVL
QVKEDYSSLLETAFKTEFITSLSKRFKERTNGGNLHLDFKQQHNITLKKTRFGGGTRTVS
FTLDAGGSAQAMLNGSSKGLLVTIGPGMPNSTRPSLARPSGGYAPGRQSVRRQKARREMS
EQLDNAPRVIGGGAAPSSHARQESTIGGGAAPVGWNQQENTRPSEPAFVPPAHAAAAAAA
PPPSAANMYGAVATPFANGGSIQSMLRPVQNSQHAAPAAAAAPAVAPRPKPPLPSKPRMT
PCVVALYPYDAQDTDELSFQPEDQIELIQKHESGWWQGRIRGQTGLFPSNYLICTFAYLA
VVIVVSDDHGDSY
Download sequence
Identical sequences H3EN16
PPA11158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]