SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA11306 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA11306
Domain Number - Region: 116-170
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0234
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 27-56
Classification Level Classification E-value
Superfamily WRKY DNA-binding domain 0.0641
Family WRKY DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA11306   Protein: PP26161   Gene: WBGene00100860
Sequence length 209
Comment PP26161 WBGene00100860 status:Partially_confirmed
Sequence
MIRKRRMKYYPPDFDPTKLPRAKQPKNRQWREPADEFYLGMRIWRFYFKCPNCLADISFK
TDLENCDYQAENGATRLFEAFKLWKDQEKLKEAKEEEDSKDPMKQLEKRTKISRAEMEAM
GKLEEMQELNRRHEGAATTIDSYLEKTDVRLTMAQALKRQEEIDEDEVRSIFGKTEDGKY
AKRIKDEDDNDEAIDLDEDMKNELKAIPK
Download sequence
Identical sequences H3ENG4
PPA11306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]