SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA13501 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA13501
Domain Number 1 Region: 134-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-66
Family Protein kinases, catalytic subunit 0.00000413
Further Details:      
 
Domain Number 2 Region: 19-79
Classification Level Classification E-value
Superfamily SH3-domain 0.00000427
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA13501   Protein: PP00071   Gene: WBGene00103055
Sequence length 496
Comment PP00071 WBGene00103055 status:Predicted
Sequence
MRQLLKVQTIILTVLLGRKSPHEKLIALHNYESTNVRKYLSFEKNDDFELRVKHLKSGRK
GLVPSNYVAKAADKEIFEWVNLDFSAIDTEKKLRHGKYQSEYPGCLDQRLIYSVKKRIDA
WEIDPSELMIDWEKEALGSGHFGEVRLAKLDGRNVAVKTLILGQGMTKEQFVQEAVTARR
LDHDNIVRTLGVCTAGPYIVAEFLHGGDLKKYLQRMKADKMTLTENEYVAVAMRIASAMA
HLEKNNIVHRDLAARNLLVGQSLNDIKLADFGMARYLDDAIYYKTHKELFPLKWTAPEAF
VIIDNNDVIVQPGRSTSKSDVWSYAVVLWELYSMGANPYDGKNVGEIYGYLMAENIPLAC
PTSCPPNSIYQLMLKCWSLNPADRPTFAQIVTYLHEYSAGTAEEPNFNDTQFEEFTNWSV
LDRLSAKGSRDQSGKFTMNFSSISYLNGHCIERTATNWILKADCPKHIDCSQQFTVFFTD
VLPSIARPTLNVFKYT
Download sequence
Identical sequences H3EUL8
PPA13501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]