SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA13505 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA13505
Domain Number - Region: 21-80
Classification Level Classification E-value
Superfamily SH3-domain 0.0273
Family SH3-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA13505   Protein: PP04217   Gene: WBGene00103059
Sequence length 119
Comment PP04217 WBGene00103059 status:Predicted
Sequence
MCTVLIDRMVETVRCCKSRTEEEEVIAIENYKPLGSSSALSIKKDDRKVKSRSSGRVGFA
PSRILAKIADIQHFEWISFDATRITEEALLMNPKLKNTVDSKTCNVLKEAIVKRLRRLN
Download sequence
Identical sequences H3EUM2
PPA13505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]