SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA14238 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA14238
Domain Number 1 Region: 176-257
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-18
Family SH3-domain 0.00091
Further Details:      
 
Domain Number 2 Region: 30-145
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000114
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000834
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA14238   Protein: PP08751   Gene: WBGene00103792
Sequence length 293
Comment PP08751 WBGene00103792 status:Predicted
Sequence
MEAVAEFDFVATDSDEELSFRRGQLLKVLDMEEDEHWFRADLDGKEGFVPKNYLRMLPCS
WFVGRVEPAVLTQRLKKKAPGSFLKGDYAISVKESAHDVVQHYRIKREQGLYSVWDTSFR
SLNELIEYYSHCSISRMTKSILVKPRREPEPPLVLQQLQHLQQPLQTSAPPQPAPHPPPA
IPTEESSQKSPPNSPLDDCDDDIVQAMFDFDGVEPDDLPFKKGDLIRVTGRDASGWATGQ
HFNGHTGTFPESYVEAFRRASSHRGMERRKVTSTSAGSGAAAKARKARLANGS
Download sequence
Identical sequences H3EWN9
PPA14238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]