SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA14350 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA14350
Domain Number 1 Region: 166-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.96e-35
Family Nucleotide and nucleoside kinases 0.00023
Further Details:      
 
Domain Number 2 Region: 31-113
Classification Level Classification E-value
Superfamily SH3-domain 7.48e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA14350   Protein: PP10616   Gene: WBGene00103904
Sequence length 341
Comment PP10616 WBGene00103904 status:Partially_confirmed
Sequence
MEPSEIGLLLTDMECGSVSLKMHPADPPTSISTVSNIHLRALTDYDSSSDRSHPCSESGV
SFSRGDIIELLMCGDDYWWQGRRIGKGAFAGTNAIVNGESHESVGLFPSETLMLKRKSGG
TIGKRREIDGLGTIRSHSSKGSRDLEDSLPYESVCRLSPSSLPHPRPILLIGAPGAGRNE
LKRRLMTLYPKRFSSTVPHTTRQQRENEANGVQYHFVTRPRMEEMINKGEMMEFGEFKGN
LYGTALSALHLAATKGMPLLTPHPLALKALRSPSFIPFIVFIRPPSKKDFINSRSAAALT
RGRPFTENEIDSIIEQSQAIEKTHSAHFDAEVSDRNGKECM
Download sequence
Identical sequences H3EWZ5
PPA14350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]