SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA15554 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA15554
Domain Number 1 Region: 60-141
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.66e-20
Family Transducin (alpha subunit), insertion domain 0.00011
Further Details:      
 
Domain Number 2 Region: 15-56
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000442
Family G proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA15554   Protein: PP07367   Gene: WBGene00105108
Sequence length 142
Comment PP07367 WBGene00105108 status:Partially_confirmed
Sequence
MGCVNSTDKSAKMRSKAIDDMLRQEGDRAARDVKLLLLGAGESGKSTIVKQMKIIHETGY
GEEERKAYRPVVYSNTIQSMMAILRAMNQLKVDFADRRRQNDARSFFQLSLNSDEGELSP
DLAAAMQRLWADPGVQECFARE
Download sequence
Identical sequences H3F0D9
PPA15554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]