SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA15755 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA15755
Domain Number 1 Region: 34-79
Classification Level Classification E-value
Superfamily SH3-domain 0.00000268
Family SH3-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA15755   Protein: PP05487   Gene: WBGene00105309
Sequence length 93
Comment PP05487 WBGene00105309 status:Predicted
Sequence
MGYEQAQVRQNTRGNEFHSLDDVYYSGGQQAHEQVAIEKHVAENDREIDMEVGDLLGIAG
NHWDGFSKGTNRRTGKVGMLKDGMKHDELEIEN
Download sequence
Identical sequences H3F0Y4
PPA15755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]