SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA15763 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA15763
Domain Number 1 Region: 215-369
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-31
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 2 Region: 548-682
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-26
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 119-262
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-24
Family Spectrin repeat 0.00048
Further Details:      
 
Domain Number 4 Region: 421-541
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-19
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 5 Region: 1-131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000219
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 6 Region: 664-747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA15763   Protein: PP29401   Gene: WBGene00105317
Sequence length 753
Comment PP29401 WBGene00105317 locus:Ppa-unc-70 status:Predicted
Sequence
ERLEQLRHAAVHLADDKPEFHGTIDPQIEELATQWEQLEKTTEEKGQKLFDANRQQLYVQ
SIADMKEWAQQLEQEMVREDQPSDLTTVNVAMQKQQMIETEMVKRAAHIDQLMAMEPQLE
EMHPETLEDIKAHRLAVQEQLQRLQAPLDDRRRLLERRKNAFQFGRDVDDEKIWIAERIN
AARAKNLGDSLPDCHRLQKNTQSLQAEIDNHEQWIESICNNGRELIDAGHENSAAFELRI
SELRDAWKELRDAIAERKERLGESEKAHQFLHDCGEAEAWMSEQELYMMQDERGKDEFST
RNQIKKHERLQNDIDKFANNIRDLSGKAQNFMDENSPLSEQIALRQAQIEKLYAGLQDLS
KERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHERFQQFARDTENIGS
ERVSNANEGCDRLISDGHSDAPTIALWKDSLNEAWENLLELMDTRAQILESSRLFHKFLH
DCRDCLSRIVEKSHAMPDDLGRDSSSVGALSRKHNNFLKDIEAIGEQVRQIQRDALALRD
SYAGDRSMEIGQREGEVVKAWNELRGSCESRSMRLGDTSDLFRFLNMVRDLLAWMDEVKR
EMNTHERPRDVSGVELLMNNHQSLKAEVDAREENFSACIALGRDLLNRKHYASSEIEKKL
IRLTTERAEMMRKWEDRWEYLQLILEVYQFARDAAVAETWLMAQEPYLVSREYGRNLEET
IKLIKKHEAFEKSASAQEERFLALEKLTTVCNY
Download sequence
Identical sequences H3F0Z2
PPA15763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]