SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA16080 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16080
Domain Number 1 Region: 260-496
Classification Level Classification E-value
Superfamily Caspase-like 9.72e-28
Family Caspase catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 125-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000904
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 5-83
Classification Level Classification E-value
Superfamily DEATH domain 0.00000177
Family DEATH domain, DD 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16080   Protein: PP29167   Gene: WBGene00105634
Sequence length 635
Comment PP29167 WBGene00105634 status:Predicted
Sequence
MTLRLDTNLAELPLPILNQLSSSLNQNETWLKVLDNDKKNAFYSSPEEIDKVTRQSNPAE
AILQRWGNRGQNVQSLIVRLQWLSFDQGFGVAFDRPQLVLKRKFKALRWASEANPIKIVS
DDDRQEICLKARAVGFPSPQFEWLRDGEPVGVPGRALRVSKCKCEATCQYICRVWNEVED
GQSFSDFYRVEGKQYSSELRSNPVDLTSHVQGTTQTCDRCKTAELEKIREKLGGSMVEDG
VERPPSEQVAAACEQLVAADKVALIISNCSYLHLPPLRTPHCDAETLAGALQFYGQPETR
LRLELHFKTVTLADLTLAEMKYMIGEYRRLLGNDVYAVLYFAGHGFEVNGQCYLLPVEAP
LEAHSPEFALSMHWVLASLDSCSPALHLILLDVCRKYVPEECVPLFLRDVGEERKHKPNR
NTVYGYSTSGGIAAYEVKGEVNGVFMSALKMHVKSPVPVVDMIQRVLVDIHADERVEKKQ
IPELRTTLTKKRSLCDELICDGHTASFDRHNVHWTLMHELPMPVYITFEEQQLTVTIWFD
FCGRFTNKVYVFSSVDQLRTEDNEEGTTEGEERAMRHLAYLRFSKDLDSSPSRLVTDEHE
GQSMCVLLSHLQKSKGPLECTVELTDAQTKESQIN
Download sequence
Identical sequences H3F1U9
PPA16080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]