SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA16558 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16558
Domain Number 1 Region: 164-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-62
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000369
Family DEATH domain, DD 0.0079
Further Details:      
 
Domain Number 3 Region: 599-716
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000337
Family Adenosine-5'phosphosulfate kinase (APS kinase) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16558   Protein: PP04928   Gene: WBGene00106112
Sequence length 943
Comment PP04928 WBGene00106112 locus:Ppa-nol-9 status:Partially_confirmed
Sequence
MNAELMVSLSEILDTGDLWIELADMMPGIERIDVEGCRKRSEHGSPSAFLLRIWASKGYC
VVDLYNLFAMCRLVRCMQLIRNEVDPRFHFLEDYCTANTPRRADVHNRPQSSILATGGTS
HAPSSARGHIHTPTSRVGGGSTITASTNPSTAHGKATRDDANMFAGMMNTPSVTYAELKS
ATDDFDSKNVIGRGGYGIVYRGEWKQNQVAVKRLSVSSKRGDSQKEADTKERLKQSLQEL
NTLAMFRHDNILPVYGYSLDGPEPLLVYQFMANGSLDDRLQCKKGANPLSWKQKAVIAKG
SAMALHFLHTISGRPLIHGDVKTANILLDKHLEPKLGDFGLSREGAVETDMDDKAVFIAS
HIKGTLAYLPPEFISSKFLTTKLDVYAFGVVLLEMASGLRAYLDSRRPAPLVDYAVDIEH
KMRSQMGGDNDGIEIRIKKKIWNEVKDKRTPGDNIDAIASKEEERYCRCEIDGGLVKEIT
KGENTWHNVCAPFKNGRPLSPSTEEILDYVSRAGDKDYAILQVSKMPTVEARIAHSLHER
FLAPVQMGTRYSSHFTASFFNLLLPDTFVPQSYSEESIRRIDTMIDDLLSYNGPDRLSVV
LTGSKGVGKSTFSRKLVNYVWSDTGRSIYYMDLDIGQSEFTPPGIISCTKIKKPILDLPF
NHQEISFENAFFVGNITVKEDDEKRYLSAVDALYDRYLEISPPNSTLIINTMGWIESFGR
DVLNHVCHLSPVSSQFRSPLSAANLRELATISYFAKCLPESRPSLSAMVEAIPFQVDFNS
LCIILPPGHRSLPDKAVFAALNLSVVALCSIGDCKLNKATRRRMLGSDQLPWLVLSTPST
PPTRVLGYGIIRGADMENRRLHVISPLSIEEMNEVDSLATLQGVPLPLPIIQAQSHAHKP
YLLGNGEDNEPKKGVIADLYVPFKYKEFKTGYTTLHYDGNYTR
Download sequence
Identical sequences H3F369
PPA16558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]