SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA16722 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16722
Domain Number 1 Region: 112-432
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.29e-63
Family Protein kinases, catalytic subunit 0.00000325
Further Details:      
 
Weak hits

Sequence:  PPA16722
Domain Number - Region: 449-502
Classification Level Classification E-value
Superfamily SH3-domain 0.00013
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16722   Protein: PP16704   Gene: WBGene00106276
Sequence length 572
Comment PP16704 WBGene00106276 locus:Ppa-ark-1 status:Predicted
Sequence
MPEAPTIIHASIALPSSAATVNGIPSLKTLLDAADLLSFEHPLTCVLHLRHAGDIEYVDE
NDLLGIGMSRPEQKRLRKEYARLFPKSSVFGKLKKAFSREENRRAEERSGADQHQHVIPL
DKITLAKELGRGEFGTVHMAYWNEGGGATTGERGGKEGELKVAVKCISSEKLLNNPTSFL
SVCNSSDTVLVDTVLPFPEAAIMHRMHHDDVVRLYGVVLDTKQIMMVSELASSGSLHSCL
LNPSLRDSFPVQVLCAFAIQIQAYLISDPFRSLISDLSSVQIARGMAYLEAQRLIHRDLA
ARNVLVFSATKVKISDFGLSRSLGVGEDYYRGEFSPTLRLPIAWCAPECINFLKFTHSSD
VWAYGVTLWEMFAYGRMPWEGKNGAEILEAIDKQRRHLARPRLCPEDMYALMGECWAHDA
GARPTFAALLAQLPDRLPLHVRAVVTMSSAPSADHLVYNRDDLIYVIDKNPEECPDGSYW
LGSLKNGRTGLFLPKDTVAHLGAEPPATNRGETEEKKKEEKEKKEKKSKEKENTREKMKA
LIGEPQAVRHTAHLGVDGAYFGLLQICVEIEI
Download sequence
Identical sequences H3F3M3
PPA16722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]