SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA16843 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16843
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-20
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16843   Protein: PP14853   Gene: WBGene00106397
Sequence length 97
Comment PP14853 WBGene00106397 status:Predicted
Sequence
VESWLSAKEEFLHKGELGEKPDEVTSLISKHETFEHTLHAQSDKLNALVADGEKLANLPG
GEYTTAIEDRLEAVKSRHARLLDACERRKALLKDSLX
Download sequence
Identical sequences PPA16843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]