SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA16972 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16972
Domain Number 1 Region: 1188-1341
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-32
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 2 Region: 1081-1237
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-30
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 977-1129
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-28
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 3-119
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-27
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 1401-1553
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-25
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 397-514
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-22
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 198-334
Classification Level Classification E-value
Superfamily Spectrin repeat 6e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 741-866
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 1552-1668
Classification Level Classification E-value
Superfamily Spectrin repeat 7.44e-18
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 121-234
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-16
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 11 Region: 571-693
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000588
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 12 Region: 1348-1418
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000101
Family Spectrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16972   Protein: PP24721   Gene: WBGene00106526
Sequence length 1705
Comment PP24721 WBGene00106526 status:Predicted
Sequence
MSADASEEDYESISSDLLGWIRDAIKHLSSRNLPNSLHGIQQQLILFNQFRNTDKPPKYK
EKGELEALFFTIQTKRKAMSRKAYVPPQGKFMHDIESAWVALERAESERQAALTEELLRQ
QRLERLAERFLKKAQLRESWLRDMGRVVEQLELPRTAGEVDATLKKHHGISADVLPREER
FKVLSEMCVDLCRENYHESDKIRAREREIIERWTSLLAHLEEKRLALEALNNLMTLLRDL
DALSTELQQLEPLVRARDVGKHMLGVEDLLQKHALLETQIHGHGTWLAQMQREAATFLRS
RGEQAEVLQRRLEDVSGQYQSLVELCAARRAALQRARDLFQFVQDDEEERAWLAEKQQVC
QRALESSDISHVPQIQRLYKNVETEMQSHWTRSKEIIAAGERLIAAGHPKDDIARRTAAI
QSAWDSLRGVMKKLGQWLSDAQHAQQYFQDANEAESWMREKMPLVRSDDLGKDEFAAERL
LLRHTRLEEEIHAYRADIVRLEELANQLSTSHFHSASTDATVVMDEDITVTTTRTRKKTT
KKASANVDGRQAIVDRQKIISADYRALNRLADERRRLLSDNIKLMRFYRECDEFETWTRE
TERALVEEPTVENVEEFRKRFEIVKKVRKRFERLENDIRTNGGTQLKCINDMAEELLGEG
HSQSRQIESRQRAVNAAWAHLEKLRAQKAARLSTVEHVAEFDAACDDARTWMKTKFDMID
QNPNDLKSLQNLERDLKPLEDRIKQLEQMANDVRAEHPEQAAAIEAKMRELQRLHQQLLK
AAKERIQQAEQTQGQSMFDSALRDMHAWCEKTKKELSEDVRPVDVAQAEELLKKHFDLGE
TIKDKKYEVEYVNDLGRRLLEKNPRLAVVKDALAGLDKEMNGERLTPADTLCSAPFWGSH
AQYSNMIRSLWKDRDIFLQQHLDLQIFNREAERIDAASKGHEAFLDYADLGDSVESVEAL
LKRHRDLEAKLDAQEGRMAAFAKNADELCKQRHAEAAYIEQRRREVLERRAAVRRAGAER
RRRLEASLEYQSLKRDGQEMLGWIAEKKKVASDDSHRDLASIDVKLLKHEAFEAEIKANA
PRVEQINKEGAVLVSTRHYEAPAVAKLVESVNTEWAELRDAAARKGERLRQAADQKGLNR
VLDDAHTKLDELENVLRSQEYGNDLRGVKELIQKHVVFEQELALHEKRLKDIAKKGEGMA
AAGHFDADRIQRTVRQLLTRFDALKEPTRQRRIALDESMQWHQLAFDVDCELQWIAEKVP
IAASEDTGRTLTEATAMLRKQEQLEAELAQHVDAIEKTIGRGNELIAKKHPAKEAIHAKC
DELNAAWSNLSSLIRRRKQIVDWGIREQQYLADANEVESWMTEKRPLIESDDYGVDEDAA
QKLLTKHKALMNDMHTYKKWLEKLAGKCGELVTARRPHADRFEKRQAELEREFERLSARA
EERRRALEDALCLYEYLRESADLEAWINAQLQAAMSEEYGEDYDHLKELQSKFEEFKQTV
KTGTERFRSCEAAANSILRRSPPFAKDILKRQEKLRSVWTLLVDYIESREAKLRAAEELH
RFNRDVAEHEESVTGKLHSIPEDTGRDVKQVHSLWQKHEAFEKQVISLEESMQSLLTESA
RLKEAYPGGNAEHIGAQQAALTESWQYLRDATDDRKQRLKAAYDLHRFVGEVRDLLNWAD
MKVTEMQSEQNTHDLQVDINYDLES
Download sequence
Identical sequences H3F4B0
PPA16972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]