SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA16973 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA16973
Domain Number 1 Region: 835-947
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-30
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 155-306
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-23
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 288-412
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 475-626
Classification Level Classification E-value
Superfamily Spectrin repeat 2.61e-20
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 48-200
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-19
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 601-694
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0063
Further Details:      
 
Weak hits

Sequence:  PPA16973
Domain Number - Region: 1-61
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0705
Family Spectrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA16973   Protein: PP21302   Gene: WBGene00106527
Sequence length 1231
Comment PP21302 WBGene00106527 status:Predicted
Sequence
MNELEKWMDGIEGELASANHGTDLNTVDELLRKLESIDAEVRGRSEGVEELMKKAKDVKG
KDALEVSLLLEKSAALEDRYRKLAEPVHIRGENLREWRKLYEWKALANEELQWLRSRLPE
ATSTDVGESLAAAQSLMEEHAALESGLESRQSAIREVEARGAEMIRHRHHRSDEIQKTLD
DVTTSLLQMRGGMEERRRRLGDAIQAHEYYSGVAKAEKWIRTKMVVASNQETGKDAAAVV
QQERTLAILDKDVEKFRDELDRLAKIADRLTTGGHRDSTQITARQTRLSSAYSDLVRECN
KRRQLLLNAMTYHDFVKRADTLAEWLHAKAKTASSEEYGRDLEECATLIDEFETVIRELA
ANGERVAAVQRSCDEQLRANHPYSASIRAKGEDLQRLWHAVNEDANERQQALAGARQVHK
FDQEVDETIHWLNKKERTGTALEQEDLAKTDLEGVKRLIQKQDEFVHGMKAVEKQVRELC
SEAERLAVLYPQTRSHLEIRRLDMEEQLKDILQSMGKHYEKLREAELLQAYFQEHRELMA
WTRRVQDSITSESLAQTVAAAEALMARHAEYATEMKARSSHVEKFVQRGKHMVQSGHVLS
SEIAEKVESLQRAFALLAEIWAERHALYEANLDVRVWQANASQLEHWMVERESMLGEDWR
LIDSVDEAETKLREFDDFLVTLDAQGEKRELVKRLTLIETKFAHIKKKEVEKIRVEEDAT
KKREEVIKVARNNLIANRRLERERRKTQEISLLKPAPEEIVSQTLPRNNKDKRERSKTTA
FGDASVAAALASASSPAPLVVETAAEATGTLQRTTPAFTTRRQSSMRKTAAWEDSTIDMK
GFVDRKHQLQAGGLKATVRSWKNYYAILCGQLLCFFKDEQAFHDASAAAAPLNIYGAVCR
EDKEYLKRKHTFRLRTSDGSEFLFSCASDDEMQSWLDRIQYHAGLAPKDQLRSFSNSVTS
NGSGGAGVASTSSSSEYRPHASSYEQRGLTDTSAPVVPSHRPPPAFATIDTTPVRSGDSL
QRRTSGLRASGRREEEDRTSLASCSATALDHSSPLRSSSTSISTPLPTLYDAAIPLRTAL
SRRESRRNLTKSVYESIYGAEDLPQVESPEEGSPSSYSTAGTTVFRTEVRELEYREATSV
SYQKDDCSVHRNSSTSFSDAQPSGAPPPPTMPRKNTMPAEGEFVAWVEKYGNSQQNLSMG
GNSSADDSDSIKSGKKKGIGSFFKRTTSSKK
Download sequence
Identical sequences H3F4B1
PPA16973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]