SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA17024 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA17024
Domain Number 1 Region: 361-489
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-21
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 497-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000041
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 3 Region: 296-382
Classification Level Classification E-value
Superfamily SH3-domain 0.000000015
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA17024   Protein: PP09414   Gene: WBGene00106578
Sequence length 580
Comment PP09414 WBGene00106578 status:Predicted
Sequence
MIWTISVVLLLASSADSIVFQSFGVRGTLMCGEAPAPGIRVKLWDNDMGELVDSPKLSSF
TDMEGQFEYEDWTPHNDEIDPVIRIAHDCNDGVKPGQRLFKFKIPKSYVYKGKEVPKEKF
FNLGTINLEFKPFNEERYYKGDFSKRSIIVPYPHKRHRARRHNKDVETTAAPVASSEDDP
CDYGLCTFSGKKRKSNRDRKRRNLEESANEASDEIVKKEETQEEEGCASEGACPINLTKK
RKDLRGRREIEISVDGQDSEVEMKGANKIVSSQAASGKTPQQGCRDDSRTRGKRKNNRLS
LLFHNDLSPISVDGQDSDVAMKANQELFALHGYQPTRGLGDQLEFAVNDEFWLKSDADQK
WWRVKHLPTGRNGYVPMSFIARKSEKIHLEWYDMRTTRSEAEETLLRERYIPGSFIIRTK
ENQIYSEALALTVKANVDGDARILHYVITRDAEDSFRVGGGRSFPTLALLIQYHAGHHSG
LPQPLTFSVRMNRLIDTWEISPVDVVYSEERSEDVLGSGHFGKVIKGTHMGVVVAVKTMI
IGRMSKEQFLREAEIGRDFSHDNIVRTIGVCSIKPFIVTE
Download sequence
Identical sequences H3F4G2
PPA17024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]