SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA17741 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA17741
Domain Number 1 Region: 5-281
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-59
Family FCH domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 534-592
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000131
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA17741   Protein: PP26825   Gene: WBGene00107295
Sequence length 599
Comment PP26825 WBGene00107295 locus:Ppa-toca-1 status:Predicted
Sequence
MRKMLVDQTDAVANHTSKGIEFLEKVGTLCKERAAIEEEYASKLRSLVKRNIGKKKDEDA
GFTYITAFNLILKEMDALAGQHEVLAERVKKELLPFIATKSAAHRTARKQSLNDLNQINA
NLQGARENMSKQQKSYGKAFKEAEAAFLKYNKAEKNMDISRLDLERAKNNASLRADQSEE
AKQGYAHALTIANQAQQAHFGTALPTILDRLRAIDDERIRDTKAALEMAINAEKEVSVII
TRCHDDMRRALETIDPPRDTAALVDQCRTGYAHPAPAQFEDLGRPEDVLNGGGDAMDGNG
STLKRGILGGGGNTAKKDGKGVSRKQSMHSKIFGGGSATSIEIKKNPDGTSDYSSLPPQQ
RVRRLQAKLADMEKEREKKISSKEGVVKMQQVYRDNPKLGNAADCDQQIQSYAKEIDVLT
NTMNKLRVQLDDAIAHTAPPIGGNDTPPSSRSESGASSHYSSASAAGAGSCTPAPPRPLP
PSSLNGTIINGVGTPSNTSHRTSYSEESVSSEGSRMTNNNGRDEVYDEMTMPPALGTCHA
LFDFEGGTTEGTVIMREGQEFLLVERDEGDGWTRVRAMDGRSEGFVPSSYLRCKWYPSD
Download sequence
Identical sequences H3F6F2
PPA17741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]