SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA18962 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA18962
Domain Number 1 Region: 40-143
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000142
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA18962   Protein: PP21747   Gene: WBGene00108516
Sequence length 148
Comment PP21747 WBGene00108516 status:Predicted
Sequence
MTDSDVEHPVEVEEREWSEEEDRIDGTARSIVSESAIEEIRSRIIDLFKTFYEAGDGEWL
EIREVGNVLRCLGFSPSLEEVDQFTDHTLTESKFISKDKLVAVLTTLGEPLTQNEVQAMM
NHLAVNKDGNVDWSSYVDEVIDHEEQRI
Download sequence
Identical sequences H3F9U6
PPA18962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]