SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA19956 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA19956
Domain Number 1 Region: 135-174
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000893
Family SH3-domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA19956   Protein: PP03792   Gene: WBGene00109510
Sequence length 212
Comment PP03792 WBGene00109510 status:Predicted
Sequence
MYALARAEDVRSQQISLVEYVEYLYFKVGESLSSLEGRSSTGSHRLTRFSHRVKDKQGLP
QTMLALPLTEGADTITLPGLSSPSLPASSPQPTEEGDEEEIYEEYEKISDEGFYNSTSRQ
STVIDDPSTSSEEEKKVCRVIYDFTPQNEEEIEIRAGESVLIESRLGPDWCFGREDLFLL
GRLEDSQPHTCAYKKQAYFFRCINDHLPHDNV
Download sequence
Identical sequences H3FCK6
PPA19956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]