SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA20198 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA20198
Domain Number 1 Region: 31-98
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-19
Family SH3-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA20198   Protein: PP20752   Gene: WBGene00109752
Sequence length 318
Comment PP20752 WBGene00109752 status:Predicted
Sequence
MSLVVKDPLLLLLRSGRFWNRSRMILSRLLSMVAEFAPRLEKRAWALYDFEAAEDNELSF
KTGDEMMITDDSNANWWRGRNERTRGEGLFPSSFVTMNPAEINAIKTETSIAQSTPVAAV
VRIDEEQLLKCIALLEDCDPTGAVPDPPELAQIEASSLAQAPLIDAALASVDRQSNALAM
VDVAIRNVLALYDGAVQQAAYAAPRYAPPPGQPMQQMQQAGHPQQMQQHPQYYAPPPQQQ
QPQHLQQQHPQMQHPQHPHYAAHPAQPAASADWQQQQYMQQMQQQQQQQQVHQYAPPPPG
QYPQYAPVPTGHETQQQY
Download sequence
Identical sequences H3FD92
PPA20198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]