SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA20567 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA20567
Domain Number 1 Region: 409-464
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000101
Family SH3-domain 0.0021
Further Details:      
 
Weak hits

Sequence:  PPA20567
Domain Number - Region: 21-192
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00126
Family IMD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA20567   Protein: PP02827   Gene: WBGene00110121
Sequence length 466
Comment PP02827 WBGene00110121 status:Partially_confirmed
Sequence
MSLGKATGEKFAPAKSTIAGVHNQLEKGFLPAVRHVATSAADLYRAHQQLEKAAESHVVA
LRILAESAKTAQPGAKKHGIALERLTADYEQLLKLHKNTLVKLSFLASKTTIYANGEKDK
LKEMQMGHQKKEKDFLRAEKKKEKTEEELGQFYMSEAKSFSSQQEMRYKFFVDKHLEWFD
SFVPMLKHAESFLIQEEIQEKKEEIKEEIKEEIKEIIENHQENHHHELAKEIIVEAMIKE
EIKEKMRHDIEEKINEAVVRAVEQEVHEHLHEKLHEAEEEAHHHDHGHEFTEPPQKDKND
YIEQLQKRGVAVAVLPVTALADQKPLKPVEHDYDRAPVQSPPAEIHSPYADAQRNLRPAM
LPETPPVAAPAVIHHTQPVLIAAPIVSPKPVMKAESPVSVPVQFGASDYGKTLTVLQDYG
ASSGEQITVAAGDKVVLIKSGTRGWIFVRDSVSQRTGWIPSPFAAL
Download sequence
Identical sequences H3FE86
PPA20567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]