SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA21659 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA21659
Domain Number 1 Region: 7-87
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000918
Family Spectrin repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA21659   Protein: PP11737   Gene: WBGene00111213
Sequence length 101
Comment PP11737 WBGene00111213 status:Predicted
Sequence
MLYLEEHREVGDGVAKAEELAAAHEEYERDARCDVDEARDLSATTSTLSLMGGEGAEAAA
SILPKCDELGRMADALAGALQRRGEVLRLSIQMHSQISQVR
Download sequence
Identical sequences H3FHB2
PPA21659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]