SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA21934 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA21934
Domain Number - Region: 9-78
Classification Level Classification E-value
Superfamily Spectrin repeat 0.009
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA21934   Protein: PP09141   Gene: WBGene00111488
Sequence length 137
Comment PP09141 WBGene00111488 status:Predicted
Sequence
MDEKYVPKNEEERQLLEEFEEEMKKITEAKESAQSETNAIKKLIEAEREKRISAEDEYVE
LKERWTKVEERSKKNKQRAEDFEKKSSEIVDRRKKAENKMVELMLRSDKVEERRISRCPK
TITEESSKTVENRPKQF
Download sequence
Identical sequences A0A2A6BC61 H3FI35
PPA21934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]