SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA22281 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA22281
Domain Number 1 Region: 276-400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000954
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA22281   Protein: PP14176   Gene: WBGene00111835
Sequence length 635
Comment PP14176 WBGene00111835 status:Predicted
Sequence
MDEEEERINAQLAREKMWAEEQERRRKTVEFDRQNKDAVMRTRELTRKSFRSKSTADLDD
NIVKREDAEQRRDQKQLRSQKGSYAYDAEAWRSRVSGLKRQILYNHPYSNFLFKRIKQKM
PELEDRLFSFVDTFSESERLLAAKDLQFGELRNLWKSFKADVDAMEERLAQRADLESEEI
DDDTCTYENSGDESTVGTEFSDSESQIQRTTDYTRDAVDFRRRVDQIMEKITEHETSPSA
EISLRMIAQIKKVDLPALAAILGRLMDVHASCDDGELQWNVLKSEWTRLRDAVDVRDNQL
RKILQNVAEYVQEAGDFKMRVDKIMAYLSSTTYADHTEELGSVQQIKREDIPYLESCLDR
LLDLLVKGKYEGLQKGLQFDELVQEWQRLCDVVKTREGLLLEKLSKPRFIEEVFVDDTVI
SEEDSNNPVDETCWKTPPERLSDYVEKAKDFQFRIRDINEQIASISSANYSQALQIIRRI
NLGLMRPTQNQRKSTADLDDKIVKREDAEQRRDQILYNHPYSNFLFERIKQKMPELEDRL
FSFVDTFPESERLLAAKDLQFGELRNLWKSFKADVDAMEERLAQRADLESEEIDDDTCTY
ENSGDESTVGTDFSDSESQVYCVHSYFPVLTYAAP
Download sequence
Identical sequences H3FJ30
PPA22281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]