SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA22283 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA22283
Domain Number - Region: 335-454
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00892
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA22283   Protein: PP16653   Gene: WBGene00111837
Sequence length 570
Comment PP16653 WBGene00111837 status:Predicted
Sequence
MTSREKLRSRSSSQRAPDRMPDVLPSSDRRMSDTARQIREIRERRAAIEEESRRLDEKES
ALSKNPLIRRLTSARSSVRQSKKALNEQLKHFKFTGNGGGRETDQRSAGTIDEDELSQDE
TIILRRRGRSLRASVRRKSVTDIDDIIKRKETEEQRGRLIAARPTSYFLFKQLKNDDMPK
LEEKLFCFAVKFVDQDKLAAEEDLQLRALYLMWKEFKEVEVAVDADSCTDESSGDEVEST
LAPTETTDSESHVQRACDYAREAEDFKRRVDQIMEEITEHPSSPPADVSLKMITKIKQKP
HGANHSYNQVELPALSTSLGRLLDMQAECDDDDLQWGALKIRWTRLRDAVDARAKELKEL
CEQSAYTEEADCFRSRVDQIKELITSTPSSEHNEALTMIRRIKSEHLPAMEQHLDRLLEL
LVECSYDGQQWPFETLVQEFTQLINTVKTREFQLLEQIGKKLRDEDSSEENNSRHDKARN
CEEESEQPLIIDEENGPLKIVQVEGEEGIFHETVPDKNVVRWRTAEDHNGTGEDQSQDNQ
SQFERQSTRLSFHRRLHSEMEQTFKKKGID
Download sequence
Identical sequences H3FJ32
PPA22283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]