SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA22447 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA22447
Domain Number 1 Region: 225-379
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 4-167
Classification Level Classification E-value
Superfamily Spectrin repeat 6.65e-27
Family Spectrin repeat 0.0000391
Further Details:      
 
Domain Number 3 Region: 385-497
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-23
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 603-739
Classification Level Classification E-value
Superfamily EF-hand 1.46e-19
Family Calmodulin-like 0.014
Further Details:      
 
Domain Number 5 Region: 502-610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000484
Family Spectrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA22447   Protein: PP14822   Gene: WBGene00112001
Sequence length 763
Comment PP14822 WBGene00112001 status:Predicted
Sequence
MNVQADSLLSSNQFEGSPIDERRKAIHARYTDVKDLAKQRREQLNKALNVHQFFRDIDDE
ESWIKCTVLVSSYRNRPSILREKQLLLSSDDYGRDLPGVQNLRRKHRRLDTELATHEPQV
SVVRQKGLELLRSSELQIPEIEQRMAELEHHWNQMKQATGSRQQKLKESEDFQEFLGKVE
EEEAWMNEKQQILASDNLGENMAGVQGLLKKHATLDVDLALHKQRVEDLDRLGQQLIEHG
NHHAPLIAARVDQLRKRIAQIEDLAGNRLRKLKENSDYLQFMWKCDVVESWIGDKVQQVR
SGDFGRDLSSVQILLTKQSAFDAGLNAFEHDGVQRITELKNELVSAHHVQSPAIQARHDA
VIQRWQQLLQASEARRAKLHKMQEQFKQIEELYLTFAKKASTFNSWFENAEEDLTDPVRC
NSLEEIRALREAHAEFQRSLTTAEEDFRQLQELDRKIKSFQVGPNPYTWFTMDSLEETWR
NLQKIIKERELELQKEHGRQEDNDAMRREFARHANQFHQWLTMTRQEMMEANGTLEEQLE
MLKRRAADIRTNRAQLKKIEDIGAVLEKNLILDNRYTEHSTVGLAQAWDQLDQLAMRMQH
NLEQQIQARNQSGVTEDALREFSMMFKHFDKEKAGRLDHAQFKSCLRALGYDLPMVDEGQ
PEPEFNRILHIVDPNMDGYVTLQEYMAFMISKETENIQSSEEIESAFRALSKEFRPYVTA
EELYATLAPEQAEYCIQRMKPYTDAVSGRQIPGGLDYETFRIR
Download sequence
Identical sequences H3FJJ5
PPA22447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]