SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA22448 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA22448
Domain Number 1 Region: 241-345
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-29
Family Spectrin repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 122-245
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-18
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 345-403
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000125
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 64-89
Classification Level Classification E-value
Superfamily SH3-domain 0.0000264
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  PPA22448
Domain Number - Region: 91-127
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0461
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 25-55
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 0.0575
Family Chlorophyll a-b binding protein 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA22448   Protein: PP18847   Gene: WBGene00112002
Sequence length 412
Comment PP18847 WBGene00112002 status:Predicted
Sequence
MVVPLIWCLTRRRLQQLQLRLELGDRLERLRLPEAQHGRTALLAEHPVEVRRLGTRRASR
MSVWKVEVNDRQGFVPAAYVKKIEPGAAQAHHMPQVNSIGGKQNEIEDKYQRLMMLGETR
KRKLEEACKGYQLLREANDLAEWIRSRTNVAEEAIAAQQEIGTDLEQVEVLQKKFDDFKG
DLKANEVRLQEMNQIATALTSVGQTETAVRIRQQIEDLNQRWKALEEQTEQREQQLGSAH
EVQRFHRDVDETRDWIQEKDDALNSDDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLD
EKANKLRQSHPEAAEQIYDLQKELNEQWNRLTAKANNRKEKLLDSYDYQRFLSDARDLLQ
WIASMNQLVSSQELANDVTGAEALLERHQEYRTEIDARAATFQVRRAWWCVV
Download sequence
Identical sequences H3FJJ6
PPA22448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]