SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA22449 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA22449
Domain Number 1 Region: 746-900
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-34
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 221-371
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-33
Family Spectrin repeat 0.0006
Further Details:      
 
Domain Number 3 Region: 114-265
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-32
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 4 Region: 641-795
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-32
Family Spectrin repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 535-688
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-32
Family Spectrin repeat 0.0000841
Further Details:      
 
Domain Number 6 Region: 26-159
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-27
Family Spectrin repeat 0.0000499
Further Details:      
 
Domain Number 7 Region: 324-474
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-27
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 906-971
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 9 Region: 977-1017
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000893
Family SH3-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA22449   Protein: PP27278   Gene: WBGene00112003
Sequence length 1017
Comment PP27278 WBGene00112003 locus:Ppa-spc-1 status:Predicted
Sequence
MEDTHAPPEPVLEVPPPQHIQVLETTDDIQNRRAEVLGHYDQFKKYAKIKRDHLEEARQF
QFFKRDADELEIWIREKLETAKEESYRDTTNLQAKIQKHEAFEAEVQAHSRTIANLDKTG
IDMIQHGHYASDVIKKRLEQLHALWDQLLFKLKDKGKKLGQALKLLQFIRQCDEVLYWIR
DKESFVTIEDMGMDLEHVEVLQRKFDDFLKELSNHQYRIVEIEEAARKLVEDGHEETDQI
YKKRDEVNEAWHRLSTLAATRKENLYGAHQVQRFNRDADETLSWIGEKESALTSDDFGRD
LNNVQALQRKHEGTERDLAALEGKMGQLEKETERLLETHPERKDVILAKMDEARRAWNAL
RDAAQGRKEGLNKSYALQRFLADYRDLVSWMNDMKAIIAADELAKDVAGAEALLEAHQEH
KGEIDAREDSFNQTADAGQKLLDERVGEGEDVKGKLEQLAKEKAGLLALWEERRILYEQC
MDLQLFYRDTDQAENWMAKQEAFLANQDLGDSLDSVESLIKKHEDFEKSLNAQEEKINAL
DEFATKLIQGQHYEAPKVAERRQALLDRRRRLTQRAMERAARLAESYKRQQFDRDCDEMV
SWMTEKLKTARDDSYLDPTNIRGKLQKHINFEQELKANKNRLDDIKKTGEEIIDSGHYAA
DHVRDRLREVDGLWAELVDASARKGAKLREAGDEQQFNRNVEDVELWLSELEGQVASEDF
GKDLVSVQNLQKKMNLIENDYSAHNDRIDGIRQTAAAFDKDEHFNAPVILRKQEALQSRY
AALRDPLERRKRKLGDSLQGNQLFRDIEDELAWIREKEQVAASTNRGRDLIGVQNLIKKQ
QALIAEIANHESQIEAVAKAAEEMVQQGHFLAPEIRDKLAQLRDSWRALKNKAEKRRLEL
NDSLQAHQYLADANEAETWMAEKEPIVGSGDYGKDEDSAEALLKKHRALVSDMEAFKGTI
EELRRQAGQCKYQEQPVGQLGRDVVLALYDYQEKSPREVSMKKGDVLTLLNASNKDW
Download sequence
Identical sequences H3FJJ7
PPA22449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]