SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA23323 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA23323
Domain Number - Region: 92-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 17-64
Classification Level Classification E-value
Superfamily DEATH domain 0.0518
Family Caspase recruitment domain, CARD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA23323   Protein: PP00198   Gene: WBGene00112877
Sequence length 166
Comment PP00198 WBGene00112877 status:Predicted
Sequence
MHIPEQFDVNERRAQEGRREVVNDVAATFDQALTVSKVINNQLSDGILTNEKAEMIQAYT
AQLDEYAHGVLNKTMNSFSNNKKDANITGVKPIHKCEACGKVFLYRSPLLDHMKTLKCAA
VLSVKSMKRSDIAQNESPKRDNDLDKDQQANAVAGCDIGKAHPSDM
Download sequence
Identical sequences H3FM17
PPA23323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]