SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA24010 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA24010
Domain Number 1 Region: 208-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-83
Family Protein kinases, catalytic subunit 0.00000000589
Further Details:      
 
Domain Number 2 Region: 99-240
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-36
Family SH2 domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 30-118
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-16
Family SH3-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA24010   Protein: PP01235   Gene: WBGene00113564
Sequence length 829
Comment PP01235 WBGene00113564 locus:Ppa-abl-1 status:Partially_confirmed
Sequence
MTRVWVPVREDLLAASMGGPGGATGREEASLFIALYDFHGVGDEQLSLKKGDQVRVISYN
KAGEWCEASLVATRREGSRRLGQIGWVPSSYITPLNSPDKHSWYHGAITRATAEFLLGSG
INGSFLVRESETSAGQHSISVRHDGRVYHYRINEDDGGRLYITKENKFKNLGELVHHHSM
QADGLICNLLYPAPKKHRAAQVFSLSPTAPDEWEVDRTEIAMRNKLGGGQYGDVYEGYWK
RYDKTVAVKTLKEDAMALPDFIAEAQIMKELHHKNLVQLLGVCTREAPFYIITEYMCYGN
LLDYLRKSDRAKLTPSTLIHMATQVASGMAYLESRNFIHRDLAARNCLVGESNLVKVADF
GLARFMREDTYTAHQGAKFPIKWTAPEGLAYNTFSTKSDVWAFGVLLWEIATCGMAPYPG
VELSNVYSLLEKGFRMDQPPGCPPNVYMLMLQCWNWSPSDRPRFRELHSRLENILNNSSI
DDEVDRQIQVSRSHRSSSRRSEHGDALQHMARSTTERERHSSTQSPRMFHADRRSLDPSA
MAPPPTPPMRTSIIVDHPASAFPSSSSSSDNTKPAPPRHLPLPTPPASAKPKLIKTADGR
DDVSCSSSGLSQLQRGTLGTLPKGARIDAFLESMHRGHDSLEPLDLDGPSSSLSRTGSDD
SLDESRESGGGGGKGSKEGSLKGTPFDSALILQARSKLKKTKSESPEGSIRSTGGERISP
RERDERSGAREVVSGLEKRVRTRGAGWRAESARDYPTDGGEGRERRRRRKDGGEGEWLKS
GEKDQSHVEPRSIPIAPSTSSSSSQQRDEPPLEQAKIRQLVTHKVGTRL
Download sequence
Identical sequences H3FNZ5
PPA24010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]