SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA24142 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA24142
Domain Number 1 Region: 26-148
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-32
Family Spectrin repeat 0.00000377
Further Details:      
 
Domain Number 2 Region: 149-258
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-24
Family Spectrin repeat 0.0000107
Further Details:      
 
Domain Number 3 Region: 331-459
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000439
Family EF-hand modules in multidomain proteins 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA24142   Protein: PP00420   Gene: WBGene00113696
Sequence length 470
Comment PP00420 WBGene00113696 locus:Ppa-atn-1 status:Predicted
Sequence
MVTLSISPQLATKAETAANRICRVLGVNQENEKMMRDYETLASDLLEWINRWMPWLSNRS
TDDTLPMAQQKLEDYRNYRRREKPPRIEEKGRLETLFNTLQTKLRLSNRPSFMPKEGHLI
KDIDAAWQRLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCAMHEEWSNGKEETLRSTD
YKSSGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIAQELNHLRYPDIATINSRCQSICT
QWERLGQLTSQRRVSLEEAERVAEKLDQLYLDLAKRAAPFNNWKWAEVQNAVPRRDSQLQ
NELRRQQNCERLRQVFAEKANESTTIFTRDCKGLSEEQVNELRSSFNHFDKDRLGLDAEQ
LRACLISVGFKIRPGKEGDVDLYDIMSQLDPNRMGRVLFDAFLAFMTKEAADTDTVDQMI
DSFRILAQGKPFITGDELRRELPSDQANYCMARMAPSSDPSAPHGSYDYL
Download sequence
Identical sequences H3FPC6
PPA24142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]