SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA24170 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA24170
Domain Number 1 Region: 368-440
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-16
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 296-357
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA24170   Protein: PP24255   Gene: WBGene00113724
Sequence length 702
Comment PP24255 WBGene00113724 locus:Ppa-tag-208 status:Partially_confirmed
Sequence
MRAPFENASILKYRLNEDALQQNSRRQSSPSPPSVCTAIEVDTRRAKSVGRDPLPSTSSH
STLPPQNQPPQSQTGAHRGVTPVGRPSSLTCNGHGPSTSQKTVHFHLPSYRFIDEDARGI
VTPAGRACLRCGLPRKQNDDALEKIYTAVNTEMKSRQKRSGEDRTIAASRIADRLEETAA
ELEDFIASLDANYTRRSKSNPSITPSTSKEHRQARLADATSRREIEKRKIRIQRLDLAEE
IEQLKRITNEEMTTMRAEKLGEELDRERARRHGYQPNSVPSLAHNTDRFTGLLNAYGDDR
GHSPARSTSSSTNVRTAVVLHRFVPQNERELALNKGDIVRLRRDIDGNWMEGERNGRIEE
CVDTIRQRLRAVYPFTGRNHNEMSLKMGDVVSFRRHIDENWTEGVNHIGEIGIFPSCYVR
PIEDIPQEMPNIVPDRPKTPKLPGVTFAGGISQSTRGEEGHYQAFDRPFDRMDRRSAEPQ
LQQPAVHHHIPIEQQRHSQPPAVIMPAIPPQMPLLQNPVYQNGGRDPVPNVHEVEIHLPH
PIPEACPHVDASREQQARSRAMDPHHHHQLDDTLEDLLRTLPTSTSTPILASSHHPQARH
SEPPAYQQQNQAPRFENNGYGEHARPQPVLTNGYGGREEQYGQEQQRPRQNGYSDPPSNT
TPSHLSTAPPSSQNDKVAAWQQKHSSSGYTGTASIIPKGART
Download sequence
Identical sequences H3FPF4
PPA24170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]