SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA24455 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA24455
Domain Number - Region: 71-143
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00755
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA24455   Protein: PP02360   Gene: WBGene00114009
Sequence length 526
Comment PP02360 WBGene00114009 status:Predicted
Sequence
MSDNTSKCDRNDTKMELTMKKQKEMEVQMTAHSNEIAGLQANGKDIETNLTACRETMRVS
ADQCGEMMNTWKEMNEAMNKQTVEWPAIRSELQQIQAQITEVIATMDVHKERVNAVEKKS
EELRAEFVKGETTSEKKKSELSAQQSCTMTSATPPPWELAQKKVDSDRIEPWNRPQPSTT
NGTFAVKAAAKSRSESKVEVAPVKSAMAPKPKAKNWDAICKELSDDEEDEEEDVEESALE
ALRRIGIREHVRRAYSATGKVQEILDARPVVPPENRRVIDSFMSLFRQYLDALRSVDQVV
FKWTSNMTPAEEDVFSGTLMNWHPESADFLPLAQAVLIDLPKMCEDLELLCCICRFRIFF
PINVFDHFIDGAHMSKLEEVGGDVSLLGSSVQLVLLRIGILLNRTTPVERENSLALKGLV
RYKECARDPNLRPTQDFRNKMWLEYRDRICMGDARAMKLSNIEQTLNAGDHEYYMRVIRK
WFKVEKNREKFLHDLNAHLATGSHRMLEGCFIRLARGTVDWDIKLC
Download sequence
Identical sequences H3FQ89
PPA24455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]