SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA24991 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA24991
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-71
Family Protein kinases, catalytic subunit 0.000000337
Further Details:      
 
Domain Number 2 Region: 354-417
Classification Level Classification E-value
Superfamily SH3-domain 0.0000239
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA24991   Protein: PP13430   Gene: WBGene00114545
Sequence length 756
Comment PP13430 WBGene00114545 locus:Ppa-kin-25 status:Predicted
Sequence
MSGAGLYIEEALLDVLEETGLVQFQNILCIDLHLRRIEHFEHAKDKDLIAHGIPPPAVRR
LRVALADKKRKSSLGSSNRKRDSEAMMRPNNENAQPLSAQETIKLMERLGEGSFAVVKRA
FWTRPNGQKLDVAVKILRDASPLVMEEMQAEAANLRRLQHPNLIQLYGVVEQPAMMVLEL
CPGGALLDRLRDRTKGTLLISQLLDYCRQMCKGMTYLETKHCVHRDLAARNILLSADEKT
VKICDFGLMRLLEDNERMYVMSPQKKVPFAWCPPEALRHRQFSHASDVYSMGVAMWEIFT
YGEEPWVGLKGIDVLQKVEAGQRLEKPRRCSVAIYELMLLCWKLNPDHRPKFNLLRGFLN
QNEMPTAVVRDAYDSQEEGALYLEKKDQVIVIENTGILWFGQSLRTRLFGSFPRGHVFMD
GSEQRRETTSTSTSTRSTGGSRHGSTSSATARNMGGHAHITLPIKGSFIHAGHGDIGGSS
WGSPNLIDEIYLKNPVMGQPLVSLGHSTPIVAPLPPPKKPSTLNISPGRGLNLHLDTPDS
FDEFQNEDMSPSNIHIPAPLNGFGRPSTTTTSTGLQATRPAPSRPVSVVAAPAAAPTWQQ
QQQQPRPPHPYYEPPREDTPTHQPMSGAFGGGAGGGIPLTPLQPRDYGITPVPRPAAAGT
STTGRSQSASRAVNNTPPPISATAYMPPSTSSAAGLSSILRPSNGHSQLNYYGGQSANGS
QVMDELAARLNARSTVQPSQTSFHPSTSSSLTVNEP
Download sequence
Identical sequences H3FRS2
PPA24991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]