SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA25288 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA25288
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-23
Family ABC transporter ATPase domain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA25288   Protein: PP04526   Gene: WBGene00114842
Sequence length 129
Comment PP04526 WBGene00114842 locus:Ppa-mix-1 status:Predicted
Sequence
MLLPGTSAKLDPADGKDPLKGIEIKVAFNGKWKDSLGELSGGQRSLVALSLVLAMLKFRP
APLYILDEVDAALDLSHTQNIGAMIKAHFKESQFIIVSLKEGMFNHANVLFRTRFVDGTS
QVSRTDNTK
Download sequence
Identical sequences H3FSL6
PPA25288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]