SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA25447 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA25447
Domain Number 1 Region: 57-123
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-16
Family SH3-domain 0.00096
Further Details:      
 
Weak hits

Sequence:  PPA25447
Domain Number - Region: 7-44
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0154
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA25447   Protein: PP01050   Gene: WBGene00115001
Sequence length 225
Comment PP01050 WBGene00115001 locus:Ppa-tag-168 status:Predicted
Sequence
MGGMSLSSQQPIQQTQQQQQGQYGGYGSVGGQMMGQTPVQMGGPSITEGMNGGGGAKRVM
IAKFDYDSRQLSPNVDAEQVELSFRQGDAITIFGEMDEDGFYMGELNGMRGLVPSNFLTN
SPMGRLAPSQPSEPMIRSVGFSETGGGMGGGVKKMAPARQTSQSSTGATTTTGGVKPAAK
KTSVAQGGGGMKPLAKKTSDVGKGGVPTARKTSTAVKKGEPTKLN
Download sequence
Identical sequences H3FT25
PPA25447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]