SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA25448 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA25448
Domain Number 1 Region: 52-120
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000315
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  PPA25448
Domain Number - Region: 258-313
Classification Level Classification E-value
Superfamily RuBisCo, C-terminal domain 0.0038
Family RuBisCo, large subunit, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA25448   Protein: PP09585   Gene: WBGene00115002
Sequence length 358
Comment PP09585 WBGene00115002 status:Partially_confirmed
Sequence
MEDEEFSMYENRFGSRDLSLQAAAAAESLNSTSFLDQIDDGIGELRDCAEQLERKFVALF
DYSHHMSPNPNAKQEELSFRKHQLIKVFGDVDPDGFFHGQISNRVGLVPSNMVIEIAKDD
LMPRRPIAAIVGPTENPSLRRARWGSLKSRSYDHAGDGGRRHYHRGREMDYASLDRRDVR
DIRDVRDAREVREGRDHRDRERYRRSNGSREHDERRGDYYERDREYRSRDRGEYARNPDY
PDEEFRRGPEYDRDRDRRDRERHHHEYRYDGPSSSQAPPPSGGAVNHIIPPNVSTTGSNH
LVQAGGHYTSQPGSSGLTPQQPNVPIHNQPPPQQQSYTGNGHVLTGTATMQQLQQGMH
Download sequence
Identical sequences H3FT26
PPA25448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]