SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA25660 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA25660
Domain Number 1 Region: 25-91
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000127
Family Caspase recruitment domain, CARD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA25660   Protein: PP11284   Gene: WBGene00115214
Sequence length 108
Comment PP11284 WBGene00115214 status:Partially_confirmed
Sequence
MAAIPCSRSLADMRAFQADNLDRLRDALNATNPKDFVPTLVARNVLRSGEMSAVYSKATR
EEQIGALIDILKTKNHWVGPMTDALISKNHPLETGQALVAKQLIELQK
Download sequence
Identical sequences H3FTN5
PPA25660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]