SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA25885 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA25885
Domain Number - Region: 49-82
Classification Level Classification E-value
Superfamily SH3-domain 0.0708
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA25885   Protein: PP02541   Gene: WBGene00115439
Sequence length 113
Comment PP02541 WBGene00115439 status:Partially_confirmed
Sequence
MSRGSFVSVRLSPAALLESKHRNTYEDKEIRRFEAEGWIDPAHYKIGVRFNVGQKIVMLS
EDDGFTDDDDWIYGSFNDGMFPVFAGTYKPVKSSTGATHFTLTAQARQLINFN
Download sequence
Identical sequences H3FUA5
PPA25885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]