SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA26171 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA26171
Domain Number 1 Region: 75-189
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-29
Family Ankyrin repeat 0.00071
Further Details:      
 
Domain Number 2 Region: 6-69
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-19
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA26171   Protein: PP12899   Gene: WBGene00115725
Sequence length 216
Comment PP12899 WBGene00115725 status:Predicted
Sequence
MSSLPPTPAPKPGRVKVYRALYDYTARSETEMSFLEGDLIYVTDGGPNEDWLQARCGKNK
GLVPANYVVGENVEQLSNPLHEAARRGNIEFLQDCIDNQVSVNSLDKSGSTALYWACHGG
HTAVAALLLRVPNITVSSQNKIGETALHAAAWRGHPECVRLLLDAGANPRIRNQQRQLPI
EIAKDAETAALLDSAMKADTCNSEAPNEYESESDHD
Download sequence
Identical sequences A0A2A6BUF5 H3FV39
PPA26171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]