SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA26208 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA26208
Domain Number - Region: 176-261
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0104
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 75-213
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA26208   Protein: PP03473   Gene: WBGene00115762
Sequence length 489
Comment PP03473 WBGene00115762 status:Predicted
Sequence
MLWLAALAAWNALRKGAEAQLVDLTKEKPVPKDASGLEKAVEDLANDEKALEALAQDARD
GVNPDDLDEDEKKKRDDLLNQIEKALALIKARKAAAEKALKDAQESDKLAADLAKIDSRL
APLVEEATRLLQDPDAIPSAYTSTAQQLNAATEEARPIVDAGRSSKGAKTLAGTIKKAEK
VTPVLDERFKLWNEFVDAREVANAQLDKFNDDLTAKEHEDAALSIEEAERLLAELEAMSG
DLERLKETGAMLEKDAEGLNPLYQPLQDARFFIVDTEAKENDYFNALQRLDSEIKEEHEL
NRNGGLIADEIAKCKDHVVADEEGAQSIPETTRSLLDDIRSHLQDAIDTATKKPRRYVDP
VAVQELQRQLEEVKSLEALPPAAEPAVEEEEEEDHEHAPQYDLDAAAEVMAALYPGRSPR
DVLREHGIDGVPSESETETVLSMTDDESRAGDTDGFASPVPDDADEEQLRRQRGRWRRVL
RTALPLQRS
Download sequence
Identical sequences H3FV76
PPA26208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]